C4orf50 Antibody
| Name | C4orf50 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49279 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PAQRLQEKGGMPCPALQVDNVPAPSELLSPARILAFHQELRQSICSNSQVHKSPLEL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C4orf50 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C4orf50 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C4orf50 Antibody [NBP2-49279] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3365_C4orf50-Antibody-Immunohistochemistry-Paraffin-NBP2-49279-img0004.jpg)
Immunohistochemistry-Paraffin: C4orf50 Antibody [NBP2-49279] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.