PHF7 Antibody
| Name | PHF7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49628 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PHF7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PHF7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PHF7 Antibody [NBP2-49628] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11410_PHF7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49628-img0002.jpg)
Immunocytochemistry/Immunofluorescence: PHF7 Antibody [NBP2-49628] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.
![Immunohistochemistry: PHF7 Antibody [NBP2-49628] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11411_PHF7-Antibody-Immunohistochemistry-NBP2-49628-img0001.jpg)
Immunohistochemistry: PHF7 Antibody [NBP2-49628] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.