ANKRD54 Antibody
| Name | ANKRD54 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49652 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ANKRD54 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ANKRD54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ANKRD54 Antibody [NBP2-49652] - Staining of human cell line HEK 293 shows localization to midbody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/12011_ANKRD54-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49652-img0002.jpg)
![Immunohistochemistry: ANKRD54 Antibody [NBP2-49652] - Staining of human colon shows moderate nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/12012_ANKRD54-Antibody-Immunohistochemistry-NBP2-49652-img0001.jpg)