LRRC3C Antibody
| Name | LRRC3C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49651 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC3C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LRRC3C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: LRRC3C Antibody [NBP2-49651] - Staining of human endometrium shows strong cytoplasmic positivity in cells in endometrial stroma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1431_LRRC3C%2520Antibody-Immunohistochemistry-NBP2-49651-img0001.jpg)
Immunohistochemistry: LRRC3C Antibody [NBP2-49651] - Staining of human endometrium shows strong cytoplasmic positivity in cells in endometrial stroma.