ARL9 Antibody
| Name | ARL9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49679 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ARL9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARL9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ARL9 Antibody [NBP2-49679] - Staining of human testis shows cytoplasmic positivity in spermatids.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23820_ARL9%2520Antibody-Immunohistochemistry-NBP2-49679-img0001.jpg)
Immunohistochemistry: ARL9 Antibody [NBP2-49679] - Staining of human testis shows cytoplasmic positivity in spermatids.