KY Antibody
| Name | KY Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48660 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KY Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: KY Antibody [NBP2-48660] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3119_KY%2520Antibody-Immunohistochemistry-NBP2-48660-img0001.jpg)
Immunohistochemistry: KY Antibody [NBP2-48660] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.