ACAP4 Antibody
| Name | ACAP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48550 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACAP4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ASAP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ACAP4 Antibody [NBP2-48550] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/703_ACAP4%2520Antibody-Immunohistochemistry-NBP2-48550-img0001.jpg)
Immunohistochemistry: ACAP4 Antibody [NBP2-48550] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.