BMP2K Antibody
| Name | BMP2K Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88603 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BMP2K Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BMP2K |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: BMP2K Antibody [NBP1-88603] - Staining of human pancreas shows strong cytoplasmic positivity with a granular pattern in exocrine and endocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/930_BMP2K-Antibody-Immunohistochemistry-NBP1-88603-img0003.jpg)
Immunohistochemistry: BMP2K Antibody [NBP1-88603] - Staining of human pancreas shows strong cytoplasmic positivity with a granular pattern in exocrine and endocrine cells.