Anti-SLC35F3 (aa 215-264) polyclonal antibody

Name Anti-SLC35F3 (aa 215-264) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL5687
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ELISA
Species Reactivities Human
Antigen Synthetic peptide, corresponding to a region within internal sequence amino acids 215-264 (LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFC CNKAFVFLLSW) of Human SLC35F3.
Description Rabbit Polyclonal
Gene SLC35F3
Conjugate Unconjugated
Supplier Page Shop