Anti-ZNF585B (aa 107-156) polyclonal antibody

Name Anti-ZNF585B (aa 107-156) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL6063
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide, corresponding to a region within N terminal amino acids 107-156 (RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFK VHLKVPTGEKL) of Human ZNF585B, NP_689492.
Description Rabbit Polyclonal
Gene ZNF585B
Conjugate Unconjugated
Supplier Page Shop