Anti-B3GNT8 Antibody

• Supplier: ARP American Research Products
• Catalog: 10-P9686
• Prices: $299.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC-P
• Species Reactivities: Human
• Antigen: A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.
• Purity/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit Polyclonal
• Gene: B3GNT8