B3GNT8 Antibody (R32273)
| Name | B3GNT8 Antibody (R32273) |
|---|---|
| Supplier | NSJ Bioreagent |
| Catalog | R32273 |
| Prices | $299.00 |
| Sizes | 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water) |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody. |
| Purity/Format | Antigen affinity |
| Description | Rabbit Polyclonal |
| Gene | B3GNT8 |
| Supplier Page | Shop |