Sp5 Antibody (R32265)
| Name | Sp5 Antibody (R32265) |
|---|---|
| Supplier | NSJ Bioreagent |
| Catalog | R32265 |
| Prices | $299.00 |
| Sizes | 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water) |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody. |
| Purity/Format | Antigen affinity |
| Description | Rabbit Polyclonal |
| Gene | SP5 |
| Supplier Page | Shop |