Tcf23 antibody
| Name | Tcf23 antibody |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb325608 |
| Prices | $502.00 |
| Sizes | 100 μl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Dog, Horse, Pig |
| Antigen | Synthetic peptide located within the following region: RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP |
| Purity/Format | Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description | Rabbit polyclonal antibody to Tcf23 |
| Gene | Tcf23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Western blot analysis of mouse Spleen tissue using Tcf23 antibody