Tcf23 antibody

Name Tcf23 antibody
Supplier Biorbyt
Catalog orb325608
Prices $502.00
Sizes 100 μl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Guinea Pig, Dog, Horse, Pig
Antigen Synthetic peptide located within the following region: RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP
Purity/Format Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description Rabbit polyclonal antibody to Tcf23
Gene Tcf23
Conjugate Unconjugated
Supplier Page Shop

Product images