LYG2 antibody
| Name | LYG2 antibody |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb326382 |
| Prices | $476.00 |
| Sizes | 100 μl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide located within the following region: LYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLI |
| Purity/Format | Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description | Rabbit polyclonal antibody to LYG2 |
| Gene | LYG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Western blot analysis of MDA-MB-435S Whole Cell tissue using LYG2 antibody