Anti-FSH Receptor / FSHR Antibody (aa626-659)

• Supplier: LifeSpan Bioscience
• Catalog: LS-C123579
• Prices: $445.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P
• Species Reactivities: Human, Monkey
• Antigen: Synthetic peptide corresponding to aa626-659 from human Follicle Stimulating Hormone Receptor (coupled to BSA) (YAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Rat, Bat (97%); Marmoset, Hamster, Horse, Guinea pig (94%); Panda, Dog, Rabbit, Pig, Turkey, Sparrow, Chicken (90%); Elephant, Bovine, Cat (87%); Mouse, Sheep, Goat, Opossum (84%).
• Purity/Format: Immunoaffinity purified
• Description: Rabbit Polyclonal
• Gene: FSHR
• Conjugate: Unconjugated