| Name | B3GNT8, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS177918 |
| Prices | $280.00 |
| Sizes | 100 µg |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. |
| Purity/Format | Immunogen Affinity Purified |
| Description | Anti-B3GNT8 Antibody |
| Gene | B3GNT8 |
| Supplier Page | Shop |