TECTA Antibody / Alpha Tectorin (R32651)

Name TECTA Antibody / Alpha Tectorin (R32651)
Supplier NSJ Bioreagent
Catalog R32651
Prices $299.00
Sizes 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water)
Host Rabbit
Clonality Polyclonal
Isotype Rabbit IgG
Applications WB IHC
Species Reactivities Human, Mouse, Rat
Antigen Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.
Purity/Format Antigen affinity
Description Rabbit Polyclonal
Gene TECTA
Supplier Page Shop

Product images