TMEM107 Antibody (R32772)

Name TMEM107 Antibody (R32772)
Supplier NSJ Bioreagent
Catalog R32772
Prices $299.00
Sizes 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water)
Host Rabbit
Clonality Polyclonal
Isotype Rabbit IgG
Applications WB IHC
Species Reactivities Human
Antigen Amino acids 22-57 (VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL) from the human protein were used as the immunogen for the TMEM107 antibody.
Purity/Format Antigen affinity
Description Rabbit Polyclonal
Gene TMEM107
Supplier Page Shop

Product images