| Name | Anti-SLC7A3 Picoband™ Antibody A09720-1 |
|---|---|
| Supplier | Boster Bio |
| Catalog | A09720-1 |
| Prices | $240.00 |
| Sizes | 1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Rabbit Polyclonal |
| Gene | SLC7A3 |
| Supplier Page | Shop |