AE3 / SLC4A3 antibody
| Name | AE3 / SLC4A3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346393 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-SLC4A3 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC4A3. Synthetic peptide located within the following region: DDLGKTLAVSRFGDLISKPPAWDPEKPSRSYSERDFEFHRHTSHHTHHPL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC4A3 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SLC4A3; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml