Ccl20 antibody
| Name | Ccl20 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329180 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI. |
| Description | Rabbit Polyclonal |
| Gene | Ccl20 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Rat Heart