DMRT2 antibody
| Name | DMRT2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329587 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE. |
| Description | Rabbit Polyclonal |
| Gene | Dmrt2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-DMRT2 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate