FAM174B antibody
| Name | FAM174B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329528 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-FAM174B antibody: synthetic peptide directed towards the C terminal of human LOC400451. Synthetic peptide located within the following region: FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED. |
| Description | Rabbit Polyclonal |
| Gene | FAM174B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM174B Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate