FAM174B antibody

Name FAM174B antibody
Supplier Acris Antibodies
Catalog TA329528
Prices $325.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P WB
Species Reactivities Human
Antigen The immunogen for anti-FAM174B antibody: synthetic peptide directed towards the C terminal of human LOC400451. Synthetic peptide located within the following region: FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED.
Description Rabbit Polyclonal
Gene FAM174B
Supplier Page Shop

Product images