HS3ST6 / 3OST6 antibody
| Name | HS3ST6 / 3OST6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346681 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-HS3ST6 antibody: synthetic peptide directed towards the C terminal of human HS3ST6. Synthetic peptide located within the following region: GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | HS3ST6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-HS3ST6 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate