NSUN5C antibody
| Name | NSUN5C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346851 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-NSUN5C antibody: synthetic peptide directed towards the middle region of human NSUN5C. Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NSUN5P2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-NSUN5C Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate; NSUN5P2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells