OBOX6 antibody
| Name | OBOX6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329586 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-OBOX6 antibody: synthetic peptide directed towards the middle region of mouse OBOX6. Synthetic peptide located within the following region: MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES. |
| Description | Rabbit Polyclonal |
| Gene | Obox6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-OBOX6 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate