Olfactory receptor 5T2 antibody
| Name | Olfactory receptor 5T2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346243 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-OR5T2 antibody: synthetic peptide directed towards the C terminal of human OR5T2. Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | OR5T2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-OR5T2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate