PMF1 antibody
| Name | PMF1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329320 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN. |
| Description | Rabbit Polyclonal |
| Gene | PMF1-BGLAP |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PMF1 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T