| Name | PWWP2A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329566 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-PWWP2A antibody: synthetic peptide directed towards the C terminal of human PWWP2A. Synthetic peptide located within the following region: PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR. |
| Description | Rabbit Polyclonal |
| Gene | PWWP2A |
| Supplier Page | Shop |