Saa1 antibody
| Name | Saa1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346516 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish |
| Antigen | The immunogen for Anti-Saa1 antibody is: synthetic peptide directed towards the middle region of Mouse Saa1. Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Saa1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Saa1; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 2.0 ug/ml