SEP15 antibody
| Name | SEP15 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346587 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Mouse, Pig, Rat, Zebrafish |
| Antigen | The immunogen for anti-SEP15 antibody: synthetic peptide directed towards the middle region of human SEP15. Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SEP15 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate