SLC44A4 antibody
| Name | SLC44A4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329498 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-SLC44A4 antibody is: synthetic peptide directed towards the middle region of Human SLC44A4. Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE. |
| Description | Rabbit Polyclonal |
| Gene | SLC44A4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SLC44A4; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml