TGIFX1 antibody
| Name | TGIFX1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329593 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-Tgifx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE. |
| Description | Rabbit Polyclonal |
| Gene | Tgif2lx1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Tgifx1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle