Name | TGIFX1 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA329593 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse |
Antigen | The immunogen for anti-Tgifx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE. |
Description | Rabbit Polyclonal |
Gene | Tgif2lx1 |
Supplier Page | Shop |