ZDHHC14 antibody
| Name | ZDHHC14 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329493 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ZDHHC18 antibody: synthetic peptide directed towards the middle region of human ZDHHC18. Synthetic peptide located within the following region: SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK. |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC14 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ZDHHC18 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysateZDHHC18 is supported by BioGPS gene expression data to be expressed in OVCAR3