Zfp708 antibody
| Name | Zfp708 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329106 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for Anti-Zfp708 antibody is: synthetic peptide directed towards the middle region of Mouse Zfp708. Synthetic peptide located within the following region: GEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK. |
| Description | Rabbit Polyclonal |
| Gene | Zfp708 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Zfp708; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0ug/ml