Zfp708 antibody

Name Zfp708 antibody
Supplier Acris Antibodies
Catalog TA329106
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse
Antigen The immunogen for Anti-Zfp708 antibody is: synthetic peptide directed towards the middle region of Mouse Zfp708. Synthetic peptide located within the following region: GEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK.
Description Rabbit Polyclonal
Gene Zfp708
Supplier Page Shop

Product images