Name | Zfp708 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA329106 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse |
Antigen | The immunogen for Anti-Zfp708 antibody is: synthetic peptide directed towards the middle region of Mouse Zfp708. Synthetic peptide located within the following region: GEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHK. |
Description | Rabbit Polyclonal |
Gene | Zfp708 |
Supplier Page | Shop |