| Name | IL-2 Antibody | AbD22297 |
|---|---|
| Supplier | AbD Serotec |
| Catalog | HCA268 |
| Prices | $225.00 |
| Sizes | 100 µg |
| Host | Human |
| Clonality | Monoclonal |
| Isotype | HuCAL Fab bivalent |
| Clone | AbD22297 |
| Applications | ELISA ELISPOT |
| Species Reactivities | Bovine |
| Antigen | Fc-fusion protein containing the amino acid sequence 21-155 from bovine interleukin-2 |
| Purity/Format | A bivalent human recombinant Fab (kappa light chain) selected from the HuCAL® phage display library, expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a V5 tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). |
| Description | Human Monoclonal |
| Gene | IL2 |
| Supplier Page | Shop |