Name | Anti-CAR1 (aa 2-51) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | CABT-BL847 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETK HDTSLKPISVS) of Human Carbonic Anhydrase I. |
Description | Rabbit Polyclonal |
Gene | Car1 |
Conjugate | Unconjugated |
Supplier Page | Shop |