Anti-CAR1 (aa 2-51) polyclonal antibody

Name Anti-CAR1 (aa 2-51) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL847
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse
Antigen Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETK HDTSLKPISVS) of Human Carbonic Anhydrase I.
Description Rabbit Polyclonal
Gene Car1
Conjugate Unconjugated
Supplier Page Shop