Anti-CYB5RL (aa 72-121) polyclonal antibody

Name Anti-CYB5RL (aa 72-121) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL1180
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within the N terminal amino acids 72-121 (LNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPG QHLILRGIVDD) of Human CYB5RL.
Description Rabbit Polyclonal
Gene CYB5RL
Conjugate Unconjugated
Supplier Page Shop