Anti-FAM71D (internal region) polyclonal antibody

Name Anti-FAM71D (internal region) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL1480
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal amino acids 288-337 (TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELK ESSKHVTISNI) of Human FAM71D
Description Rabbit Polyclonal
Gene FAM71D
Conjugate Unconjugated
Supplier Page Shop