Anti-RSPH10B (aa 288-337) polyclonal antibody

Name Anti-RSPH10B (aa 288-337) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL3201
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide, corresponding to a region within internal sequence amino acids 288-337 (FVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKN GRVYEGAFSND) of Human RSPH10B
Description Rabbit Polyclonal
Gene RSPH10B
Conjugate Unconjugated
Supplier Page Shop