Anti-ZNF236 (internal region) polyclonal antibody

Name Anti-ZNF236 (internal region) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL3883
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen A synthetic peptide corresponding to a region within the internal sequence 1079-1128 (VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEE ETAQLAKIRPQ) of Human ZNF236, NP_031371
Description Rabbit Polyclonal
Gene ZNF236
Conjugate Unconjugated
Supplier Page Shop