SLC7A3 Antibody (N-Terminal) (R32985)
| Name | SLC7A3 Antibody (N-Terminal) (R32985) |
|---|---|
| Supplier | NSJ Bioreagent |
| Catalog | R32985 |
| Prices | $299.00 |
| Sizes | 100 µg (0.5mg/ml if reconstituted with 0.2ml sterile DI water) |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Amino acids 1-30 (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) were used as the immunogen for the SLC7A3 antibody. |
| Purity/Format | Antigen affinity |
| Description | Rabbit Polyclonal |
| Gene | SLC7A3 |
| Supplier Page | Shop |
Product images
Western blot testing of human A431 cell lysate with SLC7A3 antibody at 0.5ug/ml. Predicted molecular weight ~67 kDa.