MYO19 Antibody
| Name | MYO19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-56073 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MYO19 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MYO19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MYO19 Antibody [NBP2-56073] - Western blot analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13273_MYO19%2520Antibody-Western%2520Blot-NBP2-56073-img0002.jpg)
Western Blot: MYO19 Antibody [NBP2-56073] - Western blot analysis in human cell line RT-4.
![Immunocytochemistry/Immunofluorescence: MYO19 Antibody [NBP2-56073] - Staining of human cell line HeLa shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13274_MYO19-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56073-img0001.jpg)
Immunocytochemistry/Immunofluorescence: MYO19 Antibody [NBP2-56073] - Staining of human cell line HeLa shows localization to cytosol.
![Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human fallopian tube shows moderate positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13275_MYO19-Antibody-Immunohistochemistry-Paraffin-NBP2-56073-img0006.jpg)
Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human fallopian tube shows moderate positivity in glandular cells.
![Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human skin shows moderate positivity in epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13276_MYO19-Antibody-Immunohistochemistry-Paraffin-NBP2-56073-img0003.jpg)
Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human skin shows moderate positivity in epidermal cells.
![Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human small intestine shows moderate positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13277_MYO19-Antibody-Immunohistochemistry-Paraffin-NBP2-56073-img0004.jpg)
Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human small intestine shows moderate positivity in glandular cells.
![Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human testis shows moderate positivity in cells in seminiferous ducts](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13278_MYO19-Antibody-Immunohistochemistry-Paraffin-NBP2-56073-img0005.jpg)
Immunohistochemistry-Paraffin: MYO19 Antibody [NBP2-56073] - Staining of human testis shows moderate positivity in cells in seminiferous ducts