Anillin Antibody (CL0303)

• Supplier: Novus Biologicals
• Catalog: NBP2-52908
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: CL0303
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
• Purity/Format: Protein A purified
• Blocking Peptide: Anillin Recombinant Protein Antigen
• Description: Mouse Monoclonal
• Gene: ANLN
• Conjugate: Unconjugated

Product images

Western Blot: Anillin Antibody (CL0303) [NBP2-52908] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-ANLN monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensi

Immunocytochemistry/Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in U2OS cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human tonsil shows strong immunoreactivity in the germinal center lymphoid cells.

Western Blot: Anillin Antibody (CL0303) [NBP2-52908] - Lane 1: Marker [kDa], Lane 2:Human cell line U-251 MG

Immunocytochemistry/Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in A431 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunocytochemistry/Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in HeLa cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunocytochemistry/Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in MCF7 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunocytochemistry/Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in U251 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human colon shows strong positivity in some glandular cells.

Immunohistochemistry: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human colorectal cancer shows strong nuclear immunoreactivity in a subset of tumor cells.

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human liver shows absence of staining (negative control).

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human lung cancer shows strong nuclear positivity in a subset of tumor cells.

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human testis shows strong immunoreactivity in a subset of cells in seminiferous tubules.