Rhot1 Antibody (CL1095)

• Supplier: Novus Biologicals
• Catalog: NBP2-52965
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: CL1095
• Applications: IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
• Purity/Format: Protein A purified
• Blocking Peptide: Rhot1 Recombinant Protein Antigen
• Description: Mouse Monoclonal
• Gene: RHOT1
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human small intestine shows cytoplasmic immunoreactivity in glandular cells.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human cerebellum shows strong positivity in Purkinje cells, as well as in molecular and granular cell layers.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human cerebral cortex shows immunoreactivity in both neuronal cell bodies and neuropil.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human colorectal cancer shows strong cytoplasmic immunoreactivity in tumor cells.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human kidney shows strong immunoreactivity in renal tubules and moderate staining in glomeruli.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human liver cancer shows strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: Rhot1 Antibody (CL1095) [NBP2-52965] - Staining of human testis shows strong granular cytoplasmic immunoreactivity in seminiferous tubules cells.