PCM1 Antibody (CL0206)
| Name | PCM1 Antibody (CL0206) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-52878 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | CL0206 |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE |
| Purity/Format | Protein A purified |
| Blocking Peptide | PCM1 Recombinant Protein Antigen |
| Description | Mouse Monoclonal |
| Gene | PCM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PCM1 Antibody (CL0206) [NBP2-52878] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5409_PCM1%2520Antibody%2520(CL0206)-Western%2520Blot-NBP2-52878-img0005.jpg)
Western Blot: PCM1 Antibody (CL0206) [NBP2-52878] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251
![Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human testis shows moderate immunoreactivity in seminiferous tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5410_PCM1-Antibody-(CL0206)-Immunohistochemistry-Paraffin-NBP2-52878-img0004.jpg)
Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human testis shows moderate immunoreactivity in seminiferous tubules.
![Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human cerebral cortex shows low immunoreactivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5411_PCM1-Antibody-(CL0206)-Immunohistochemistry-Paraffin-NBP2-52878-img0001.jpg)
Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human cerebral cortex shows low immunoreactivity in neuronal cells.
![Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human fallopian tube shows moderate to strong immunoreactivity in the glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5412_PCM1-Antibody-(CL0206)-Immunohistochemistry-Paraffin-NBP2-52878-img0002.jpg)
Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human fallopian tube shows moderate to strong immunoreactivity in the glandular cells.
![Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human striated muscle shows moderate nuclear immunoreactivity in the myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5413_PCM1-Antibody-(CL0206)-Immunohistochemistry-Paraffin-NBP2-52878-img0003.jpg)
Immunohistochemistry-Paraffin: PCM1 Antibody (CL0206) [NBP2-52878] - Staining of human striated muscle shows moderate nuclear immunoreactivity in the myocytes.