NECAB1 Antibody (CL0575)

• Supplier: Novus Biologicals
• Catalog: NBP2-52945
• Prices: $419.00
• Sizes: 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a
• Clone: CL0575
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
• Purity/Format: Protein A purified
• Blocking Peptide: NECAB1 Recombinant Protein Antigen
• Description: Mouse Monoclonal
• Gene: NECAB1
• Conjugate: Unconjugated

Product images

Western Blot: NECAB1 Antibody (CL0575) [NBP2-52945] - Lane 1: Marker [kDa], Lane 2: Human cerebral cortex lysate

Immunohistochemistry-Paraffin: NECAB1 Antibody (CL0575) [NBP2-52945] - Staining of human liver shows absence of immunoreactivity.

Immunohistochemistry-Paraffin: NECAB1 Antibody (CL0575) [NBP2-52945] - Staining of human cerebral cortex shows immunoreactivity in a subset of neuronal cells.

Immunohistochemistry-Paraffin: NECAB1 Antibody (CL0575) [NBP2-52945] - Staining of human kidney shows positivity in renal glomeruli.