ACOT1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-54709
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a Recombinant Protein corresponding to amino acids:YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: ACOT1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: ACOT1
• Conjugate: Unconjugated

Product images

Western Blot: ACOT1 Antibody [NBP2-54709] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue

Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709] - Staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: ACOT1 Antibody [NBP2-54709] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.