SLC25A24 Antibody
| Name | SLC25A24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-57669 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC25A24 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC25A24 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC25A24 Antibody [NBP2-57669] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26237_SLC25A24%2520Antibody-Western%2520Blot-NBP2-57669-img0003.jpg)
Western Blot: SLC25A24 Antibody [NBP2-57669] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
![Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP2-57669] - Staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26238_SLC25A24-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57669-img0001.jpg)
Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP2-57669] - Staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26239_SLC25A24-Antibody-Immunohistochemistry-Paraffin-NBP2-57669-img0002.jpg)
Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.